Protein Info for BBR_RS18635 in Bifidobacterium breve UCC2003

Annotation: PspC domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 560 transmembrane" amino acids 52 to 76 (25 residues), see Phobius details amino acids 102 to 129 (28 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details amino acids 279 to 300 (22 residues), see Phobius details amino acids 308 to 331 (24 residues), see Phobius details PF04024: PspC" amino acids 25 to 78 (54 residues), 56.7 bits, see alignment 8.5e-20

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (560 amino acids)

>BBR_RS18635 PspC domain-containing protein (Bifidobacterium breve UCC2003)
MNSYQQPQPGKAPRRFFTWVRSSGLIRGNDRWIGGVCSGIAQRLGWSPTLVRALMIVATL
FFGFGAALYAMGWFLIPDVRSGQILAEDLIEGQWDWNCLGCFLFMAVAVLIPGAGWVCIA
LAALVLWLIAQSGVRQQEGYGFGYHGGQSTAPPNNPNGPNNPNNLAPNPSMQPSATMPPY
VSQPVSQSVPYVSQPVPQAGQRPYNPTSGSAAMPVDGIPAGKYAMPNPVAAAAPRSSTRR
KPAGPVVVLSVLGLSFISFAAVMAVIWEYDMDVSGIVRVGTIWISAVCVVMGLIVIVLGF
KGRRAGGLIPLGLMAGACAMCMIIASGTYAIRHYDATHTNISYTDITLSSAGGHASVDAY
GMNQVQVNDQFYADSSQRTFDKLVRGVWFSGDDYDSSQAVLDLSDWESSHAPHKLELSNG
NTSISNCPAGTITISAVQAQVHIILPDGCSYGIGSAWRGYTYSNSMGGKYAVIYDTVDLI
GFPDTDQGYSIDSYDTNYAWMTDDSKMPANGPELLVDIPFSAGARVNMIYISDWEGSTYM
QFRNNFDTTNGYTEDSGKAE