Protein Info for BBR_RS18610 in Bifidobacterium breve UCC2003

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 43 to 61 (19 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 157 to 180 (24 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 266 to 285 (20 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details amino acids 324 to 348 (25 residues), see Phobius details amino acids 357 to 378 (22 residues), see Phobius details PF07690: MFS_1" amino acids 8 to 315 (308 residues), 100.8 bits, see alignment E=7.9e-33 PF00083: Sugar_tr" amino acids 41 to 176 (136 residues), 27.9 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: K08156, MFS transporter, DHA1 family, arabinose polymer transporter (inferred from 93% identity to bln:Blon_2162)

Predicted SEED Role

"Protein AraJ precursor" in subsystem L-Arabinose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>BBR_RS18610 MFS transporter (Bifidobacterium breve UCC2003)
MKKSLLALASGAFILGAAEFVMMGILPQAAAATGVDIPTAGHYISAYAIGVCFGTLILVF
GRKVPPKDLIIAFMVIALMGNLFSAFSANAAMLVIARFISGLPHGAFFGTATLIAKTLAD
KGKEAQAVSIMVTGQTLANMLGVPAGTLMAEFLSWRLAFGILAAWAAMTIVLSLAWIPFV
APIKDAGIAGQFKFLTRRGPWVILAAVFTGNAGVFCWWSYISPWLQKTGGWSSSLVPMLM
MLAGFGMVVGGIIGGRITDRWRHAGTAALGQSISCIGLLLVVLLPGNHGTTALLTFWIAF
GLFFISAPQQLLMTEAGQGGGELIAGAAVQVAFNFGNAIGSIVGGAMLTSFSMNYRFTGL
GGVPLTLLAVGLLTFYSWRCETDTEAIHRMREIKVD