Protein Info for BBR_RS18595 in Bifidobacterium breve UCC2003

Annotation: 1,4-dihydroxy-2-naphthoate octaprenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 63 to 83 (21 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 147 to 164 (18 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details amino acids 245 to 264 (20 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details amino acids 297 to 320 (24 residues), see Phobius details PF01040: UbiA" amino acids 64 to 285 (222 residues), 111 bits, see alignment E=3e-36 TIGR00751: 1,4-dihydroxy-2-naphthoate octaprenyltransferase" amino acids 64 to 317 (254 residues), 193.2 bits, see alignment E=3.4e-61

Best Hits

KEGG orthology group: K02548, 1,4-dihydroxy-2-naphthoate octaprenyltransferase [EC: 2.5.1.- 2.5.1.74] (inferred from 84% identity to bll:BLJ_1669)

Predicted SEED Role

"1,4-dihydroxy-2-naphthoate polyprenyltransferase (EC 2.5.1.74)" (EC 2.5.1.74)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.74

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>BBR_RS18595 1,4-dihydroxy-2-naphthoate octaprenyltransferase (Bifidobacterium breve UCC2003)
MSIGLWLKGARPKTLATSIASVMVGAAMARVHIEQMGTCVAIYPEPAYCAVNRAQQDLLL
GRFWMVTFLCLLVALFLQIAVNYANDYSDGVRGTDAGRGGSESQSGKPQRLTESGLVPAK
HVFIAAIICAGIACVCGIAAIVISQAWWLFAVGAASLVAGWFYTGGKHPYGYVGLGEVGV
FLFFGLAAVLGTEYALCGMVDVGGLLGAVAAGLFSCHILMVNNLRDIDEDREHNKRTLAV
RMGESGARTLLIVCCVIAWIIALLMCGTLWWPWGVVLLLSGAGVPVRMISSVKKHAFGPA
LGAASFQTLLFAVVLALSVAL