Protein Info for BBR_RS18585 in Bifidobacterium breve UCC2003

Annotation: phosphate transport system regulatory protein PhoU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 TIGR02135: phosphate transport system regulatory protein PhoU" amino acids 5 to 208 (204 residues), 158.7 bits, see alignment E=7.8e-51 PF01895: PhoU" amino acids 16 to 103 (88 residues), 79.9 bits, see alignment E=7.3e-27 amino acids 123 to 202 (80 residues), 41.2 bits, see alignment E=9.1e-15

Best Hits

KEGG orthology group: K02039, phosphate transport system protein (inferred from 95% identity to blo:BL1657)

Predicted SEED Role

"Phosphate transport system regulatory protein PhoU" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>BBR_RS18585 phosphate transport system regulatory protein PhoU (Bifidobacterium breve UCC2003)
MRVIFNEELKQVADDLDRMAQDVRKAIKGAGDALLNQDVEAAQTVIDGDIEIDALESSVL
DQCVKLLAKQNPVATDLRVVVSTMRLASTFERMGDLARHVAEAARRTYPAAAIPESAQPV
FADMVAFLDNTADQLVAMLTDRDAKTAEAIILADDKLDELHHRTFDLALSDEITRQQTVD
IVLLGRFLERLGDHAVSAARRVVYIVSGFDPTKEPTRDEGTDID