Protein Info for BBR_RS18570 in Bifidobacterium breve UCC2003

Annotation: phosphoserine transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01366: putative phosphoserine aminotransferase
  • amino acids 10 to 377 (368 residues), 521.7 bits, E=5.3e-161
• PF00266: Aminotran_5
  • amino acids 41 to 338 (298 residues), 51.8 bits, E=3.2e-18

Best Hits

Swiss-Prot: 57% identical to SERC_MYCA1: Putative phosphoserine aminotransferase (serC) from Mycobacterium avium (strain 104)

KEGG orthology group: K00831, phosphoserine aminotransferase [EC: 2.6.1.52] (inferred from 89% identity to blj:BLD_1783)

Predicted SEED Role

"Phosphoserine aminotransferase (EC 2.6.1.52)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 2.6.1.52)

MetaCyc Pathways

• L-serine biosynthesis I (3/3 steps found)
• superpathway of L-serine and glycine biosynthesis I (3/4 steps found)
• L-cysteine biosynthesis IX (Trichomonas vaginalis) (2/3 steps found)
• pyridoxal 5'-phosphate biosynthesis I (3/7 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (4/9 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (6/12 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.52

Protein Sequence (378 amino acids)

>BBR_RS18570 phosphoserine transaminase (Bifidobacterium breve UCC2003)
MTVNIPASLKPSDGRFGSGPSKIRTEQIAALGAGATTLLGTSHRQTPVKQLVGSIREGLT
EFFHLPEGYEIALGNGGASAFWEIACASLITRRAAFGTYGSFSAKFAASAANAPFLEDPV
LFAGEPGTYRLPELTEGVDTYCWAHNETSTGVAAPIRRVPESLEAGALTVIDGTSAAGAL
PVDISQTDVYYFSPQKAFGSDGGLWVAALSPAAIDRAAGVESSAHLEGARRWVPPFLSLT
SALNNSRKDQTLNTPAVATLIMMENQVRWLNNNGGLDWAIARCAKSASILYSWAERSDYA
QPFVSDPEARSSAVATIDLDEQVPASQVLAILRENGIVDCAGYRKLGRNQLRVGVFPSVE
PSDVTALTACIDYVVEHM