Protein Info for BBR_RS18540 in Bifidobacterium breve UCC2003

Annotation: thymidylate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03284: thymidylate synthase
  • amino acids 27 to 108 (82 residues), 120.2 bits, E=4.8e-39
  • amino acids 107 to 290 (184 residues), 292 bits, E=2.2e-91
• PF00303: Thymidylat_synt
  • amino acids 27 to 290 (264 residues), 414.5 bits, E=7.6e-129

Best Hits

Swiss-Prot: 96% identical to TYSY_BIFLO: Thymidylate synthase (thyA) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K00560, thymidylate synthase [EC: 2.1.1.45] (inferred from 96% identity to bln:Blon_2142)

MetaCyc: 69% identical to thymidylate synthase subunit (Mycobacterium tuberculosis H37Rv)
Thymidylate synthase. [EC: 2.1.1.45]

Predicted SEED Role

"Thymidylate synthase (EC 2.1.1.45)" in subsystem Folate Biosynthesis (EC 2.1.1.45)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (13/18 steps found)
• dTMP de novo biosynthesis (mitochondrial) (2/3 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (6/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (4/7 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (4/7 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (9/14 steps found)
• pyrimidine deoxyribonucleosides salvage (2/5 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (4/8 steps found)
• folate transformations III (E. coli) (4/9 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (4/9 steps found)
• folate transformations II (plants) (5/11 steps found)

KEGG Metabolic Maps

• One carbon pool by folate
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.45

Protein Sequence (290 amino acids)

>BBR_RS18540 thymidylate synthase (Bifidobacterium breve UCC2003)
MALTEEQLADIRSRIPARPQTDIPMPYENLVRKILTEGTLKSDRTGTGTISLFGQQMRFD
LSQYFPLLTTKTVFFKGLAYELLWFLKGSSNINWLLEHNVHIWDEWADENGDLGPVYGVQ
WRSWPAPTPEDPNRTIDQISNVLDLIKNHPDSRRMVVSAWNPAEVEKMALPPCHALFQFY
VANGKLSCQLYQRSCDMFLGVPFNIASYSLLTMMMAQQAGLEPGEFVWTGGDCHVYDNHV
DQFLEQLSRDPYPYPTIEIRKADSLFDYQYEDFTIVGYQHHPTIKAPVAV