Protein Info for BBR_RS18490 in Bifidobacterium breve UCC2003

Annotation: sugar ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF01547: SBP_bac_1" amino acids 44 to 331 (288 residues), 114.7 bits, see alignment E=9.2e-37 PF13416: SBP_bac_8" amino acids 48 to 358 (311 residues), 131.3 bits, see alignment E=6.2e-42

Best Hits

KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 50% identity to blf:BLIF_1994)

Predicted SEED Role

"ABC-type sugar transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>BBR_RS18490 sugar ABC transporter substrate-binding protein (Bifidobacterium breve UCC2003)
MNNTTRAVIATAAIGALLIPLAGCGNTTTSSGKTELTVWSWDASIDRAAKSFMKANPDIT
VKVSNVGSTEETYTALNNAAQAGSGLPDVTLIEYLAIPQFVHSDTLMDLSKVYNTAKLKD
TFTPGTWNSVNINGGLYAMPADSGPMAYFYDKDVFDKAGISEPPTTWDEFYEDAKKIRAT
GSYITSDSGDAGLFNAMMWAMGGHAYKLNDDKLTINIAKDKGAQRFMDLWQKMRDEDLID
VHTKTWTDDWMKSLGDGSIASLISGAWMANNLLQGVPQATGKFRVALLPTIDGTPINGEY
GGSGLAITKKIPDGKLDAAKKFVEYVTTNDEGIDARVSNGSFPATTKTLNQKDFLAKTTL
RNTDGSDNEFFGGQKYNEVFSQAAKDVTGKWEFLPFEPYARSVYNDNMGSFFAGKTSFRT
AADNWQKALKDYAKDQGFTVQ