Protein Info for BBR_RS18445 in Bifidobacterium breve UCC2003

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 signal peptide" amino acids 6 to 11 (6 residues), see Phobius details amino acids 22 to 23 (2 residues), see Phobius details amino acids 25 to 30 (6 residues), see Phobius details transmembrane" amino acids 12 to 21 (10 residues), see Phobius details amino acids 24 to 24 (1 residues), see Phobius details amino acids 39 to 66 (28 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>BBR_RS18445 hypothetical protein (Bifidobacterium breve UCC2003)
MPVLFITFGLSLALGVIRLLLRGMGSCLALTVHPVRLVVRVLALAAQTLMVMLLLLVIAF
LLMHFFAGSDAPALDGSFWTIVGVFAASLLATGVLGVADERLEERSRR