Protein Info for BBR_RS18215 in Bifidobacterium breve UCC2003

Annotation: AI-2E family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 530 transmembrane" amino acids 45 to 66 (22 residues), see Phobius details amino acids 72 to 95 (24 residues), see Phobius details amino acids 103 to 127 (25 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 231 to 267 (37 residues), see Phobius details amino acids 269 to 299 (31 residues), see Phobius details amino acids 305 to 322 (18 residues), see Phobius details amino acids 341 to 366 (26 residues), see Phobius details PF01594: AI-2E_transport" amino acids 54 to 376 (323 residues), 164.8 bits, see alignment E=1.5e-52

Best Hits

KEGG orthology group: None (inferred from 81% identity to blj:BLD_1841)

Predicted SEED Role

"FIG00671939: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (530 amino acids)

>BBR_RS18215 AI-2E family transporter (Bifidobacterium breve UCC2003)
MSESARNTDNVGTAETAASPEDENRIDFGTLFPSRGDPRRPPEWFGRALLYVAIAIIVFM
FCWRSWGDISYLVLDIIISLFVALAIEPLVVALVAHGWKRGVASMVSLVGVAVMVSVLFT
LFGNMFVQQMIAMFKGLPGTYEQIREFVDQYATFKMPEINNLGTEIVNNIQTSWVTDFAG
TAMSTVGGLFSFLLNLMTVVMTTYYISAAGPKLRRSFCQWLAPSTQRRFLLVWTVAQGQI
SSFLFSRSILALINATCTAIFLEILHVPYWLPLALFCGVVSQFIPTVGTYIGGALPVLFA
WGDRGWAYAVAVLVFIIVYQQIENLILSPRISQRTMDINAAVAFLAVLAFGSLFGAFGAF
LALPVTASLQAIFRAYTKRYDLIDSPLMNDPEPEKKSKIVEASEAFGEHVLQPLGEHMPR
AAKGSTSRVPMSEELRLLQEQIYAIPEHGGSEDDGEDSATVAIPKRVLSANARKGLRGTA
AEDDDDEPDTSAIPQRHTSTGDEAAASDAVQPESSSDNTSVSDNPRAGWR