Protein Info for BBR_RS18185 in Bifidobacterium breve UCC2003

Annotation: hypoxanthine phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01203: hypoxanthine phosphoribosyltransferase
  • amino acids 14 to 178 (165 residues), 187.2 bits, E=9.5e-60
• PF00156: Pribosyltran
  • amino acids 18 to 164 (147 residues), 92.1 bits, E=1.2e-30

Best Hits

Swiss-Prot: 51% identical to HPRT_ENTFA: Hypoxanthine-guanine phosphoribosyltransferase (hpt) from Enterococcus faecalis (strain ATCC 700802 / V583)

KEGG orthology group: K00760, hypoxanthine phosphoribosyltransferase [EC: 2.4.2.8] (inferred from 92% identity to bln:Blon_0548)

MetaCyc: 44% identical to hypoxanthine-guanine phosphoribosyltransferase (Arabidopsis thaliana col)
Hypoxanthine phosphoribosyltransferase. [EC: 2.4.2.8]; 2.4.2.8 [EC: 2.4.2.8]

Predicted SEED Role

"Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8)" in subsystem Purine conversions (EC 2.4.2.8)

MetaCyc Pathways

• guanine and guanosine salvage II (2/2 steps found)
• adenine salvage (2/3 steps found)
• guanine and guanosine salvage I (1/2 steps found)
• xanthine and xanthosine salvage (1/2 steps found)
• superpathway of purine nucleotide salvage (9/14 steps found)
• superpathway of guanine and guanosine salvage (1/3 steps found)
• adenine and adenosine salvage III (1/4 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.8

Protein Sequence (187 amino acids)

>BBR_RS18185 hypoxanthine phosphoribosyltransferase (Bifidobacterium breve UCC2003)
MRIADVEEDIDHELVSREQIDAKIHEVAARVSDDYRGKDPLLVAVLKGAVNTLVEFSQAM
SIPVQIDFMSLSSYGSGTVSSGEITVRQDLSADVRGRHIVIVEDIVDSGRTLAWLVEELK
RRGAASVEVFALLSKPSRREVDVDVKYAGYEIPDEFVVGFGLDYDERYRNLDSIAVLKPS
VYQGVQA