Protein Info for BBR_RS18170 in Bifidobacterium breve UCC2003

Annotation: dihydropteroate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01496: dihydropteroate synthase
  • amino acids 14 to 281 (268 residues), 262.6 bits, E=2.1e-82
• PF00809: Pterin_bind
  • amino acids 16 to 272 (257 residues), 234.9 bits, E=5.6e-74

Best Hits

KEGG orthology group: K00796, dihydropteroate synthase [EC: 2.5.1.15] (inferred from 93% identity to blb:BBMN68_1718)

Predicted SEED Role

"Dihydropteroate synthase (EC 2.5.1.15)" in subsystem Folate Biosynthesis (EC 2.5.1.15)

MetaCyc Pathways

• tetrahydrofolate biosynthesis I (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (9/12 steps found)
• tetrahydrofolate biosynthesis II (2/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (7/10 steps found)
• superpathway of chorismate metabolism (32/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.15

Protein Sequence (291 amino acids)

>BBR_RS18170 dihydropteroate synthase (Bifidobacterium breve UCC2003)
MTDLQALHDASHTMVMGVLNITEDSFSDGGLWLDPAKAAQHGRDMMAAGADIIDIGAEST
RPGAKRVSEEDELARITGAVNALIPAGAVLSIDTTRASVAAAALDGGAQIINDVSGGTLD
ANLPHVIADHDCLYIVQHWRGWLAGSKGANPDQDTSVYEHGVLTDVHDELMRQVDGVLAA
GVKPERIIIDPGLGFSKPSIEHNLPLLTGLETFRGTGYPVLIGQSRKRFISAMLTEAGAV
GEDGPTMAQRDDVTAALSALSAEHGAWAVRVHDVAKSHAAVIAGNIWRQYA