Protein Info for BBR_RS18100 in Bifidobacterium breve UCC2003

Annotation: lincomycin resistance protein LmrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 50 to 73 (24 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>BBR_RS18100 lincomycin resistance protein LmrB (Bifidobacterium breve UCC2003)
MMLYAPPTLMREFNVPSSTVQWLTTGFMLTNGIMIPVTAFLIETFTTRQLFLYAMGMVIA
FAPALGPTISGLLVEWLSWRWMFALLVAIAGGVIAAACFTVHNVGEPTHPHIDVLSVVLS
TFGFGGVLFGLSTAGGNGWGSMDVLVSLAIGVIALTLFIWRQMRLEQPMLDFRIFRMVAI
VCIICLVAPFFIRDRGLHPGQKR