Protein Info for BBR_RS18085 in Bifidobacterium breve UCC2003

Annotation: peptide chain release factor 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 TIGR00019: peptide chain release factor 1" amino acids 11 to 360 (350 residues), 450.9 bits, see alignment E=1.5e-139 PF03462: PCRF" amino acids 14 to 207 (194 residues), 213.2 bits, see alignment E=3.3e-67 PF00472: RF-1" amino acids 217 to 326 (110 residues), 133.2 bits, see alignment E=4.3e-43

Best Hits

Swiss-Prot: 98% identical to RF1_BIFLO: Peptide chain release factor 1 (prfA) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K02835, peptide chain release factor 1 (inferred from 98% identity to bll:BLJ_1582)

Predicted SEED Role

"Peptide chain release factor 1" in subsystem LMPTP YwlE cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (362 amino acids)

>BBR_RS18085 peptide chain release factor 1 (Bifidobacterium breve UCC2003)
MADEQFPAAATALEEYQSIEEQMASPEVVSNPDKLRKLGRRHAELGAIVGAYKAWLQLKD
DLEAAQEMAGEDADFAEEAKRLESELPGAEEKLRTALIPRDPDDARDTIMEIKAGTGGEE
AALFAGDLLRMYTRYAEKRGWSVNIQSENTTELGGVKDVQIAIRAKGTPAPEDGVWASMK
YEGGVHRVQRIPVTESQGRIQTSAAGVIVFPEADEDDDEIEIDPKDLKIDIFMSSGPGGQ
SVNTTYSAVRMTHLPTGITVNMQDEKSQIQNRASALRVLKSRLLAMKHEQEAAEAADMRH
SQVRSLDRSERIRTYNFPENRIVDHRTNYKAYNLDAVLDGDLQAVIDSDIQADEADRLAN
QK