Protein Info for BBR_RS18080 in Bifidobacterium breve UCC2003

Annotation: peptide chain release factor N(5)-glutamine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 TIGR00536: methyltransferase, HemK family" amino acids 4 to 289 (286 residues), 158.4 bits, see alignment E=2.1e-50 PF17827: PrmC_N" amino acids 6 to 78 (73 residues), 66.4 bits, see alignment E=8.4e-22 TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific" amino acids 25 to 290 (266 residues), 231.9 bits, see alignment E=8.2e-73 PF03602: Cons_hypoth95" amino acids 86 to 209 (124 residues), 40 bits, see alignment E=1.1e-13 PF05175: MTS" amino acids 111 to 208 (98 residues), 28.7 bits, see alignment E=2.9e-10 PF13847: Methyltransf_31" amino acids 120 to 259 (140 residues), 28.1 bits, see alignment E=4.6e-10

Best Hits

Swiss-Prot: 94% identical to PRMC_BIFLO: Release factor glutamine methyltransferase (prmC) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 95% identity to bln:Blon_0576)

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>BBR_RS18080 peptide chain release factor N(5)-glutamine methyltransferase (Bifidobacterium breve UCC2003)
MAAADVIRDAAVQLREAGIETPEHDAKLLLAEAAGVELRDVDKALLMGEELGTAEQLARF
QSMLARRAKREPLQYITGHAPFRYLDLKVGPGVFIPRPETETVVQVGLDWLTRNGMIHPR
VVDLCAGSGAIGLSVVSEVPGSQVWAVELSPNTAEWTRRNLSETAKKYPSIASNYHLEIA
DATSFATLAQLDGTVDIVITNPPYVPQTDIPEQPEVRDWDPELALYGGSMDGTLIPERII
ERACRLLKPGGALVMEHDVTQGDRLVAFARATGFAAASTGQDWTGRDRYLFAVS