Protein Info for BBR_RS18070 in Bifidobacterium breve UCC2003

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 19 to 38 (20 residues), see Phobius details amino acids 45 to 62 (18 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 97 to 113 (17 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details amino acids 230 to 258 (29 residues), see Phobius details amino acids 264 to 293 (30 residues), see Phobius details PF02653: BPD_transp_2" amino acids 11 to 291 (281 residues), 154.4 bits, see alignment E=1.7e-49

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 98% identity to blm:BLLJ_1546)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>BBR_RS18070 branched-chain amino acid ABC transporter permease (Bifidobacterium breve UCC2003)
MDQIIMFVSQLFNGLKIGSVYALVALGYTMVYGIIRLINFAHGDFIMVGAYVLMLTIPAI
VAMGLPAWVAVIPAILVCVAVGVIVEKAAYKPVREKGNSMTALITAIAMSLLLENGSQAI
FGADFQTVPTIFHLPSIAFGKLKLSGDTLLTIVIGLVIMVGLQLFVKFTKQGKAMRAVSE
DKEAAVLMGVNVNSTIALTFAIGSGLAAVASLMYCAAYPQVSPMMGAMLGLKAFVAAVLG
GIGSIPGAMIGGLAIGLIESLTKAYIGTVTGGLITSAFSDAIVFAILIIVLLVKPSGIMG
KNEGEKV