Protein Info for BBR_RS18065 in Bifidobacterium breve UCC2003

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 40 to 63 (24 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 259 to 285 (27 residues), see Phobius details amino acids 297 to 316 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 39 to 310 (272 residues), 130.4 bits, see alignment E=3.5e-42

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 92% identity to blj:BLD_1893)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (362 amino acids)

>BBR_RS18065 branched-chain amino acid ABC transporter permease (Bifidobacterium breve UCC2003)
MKKTMLSTTQSYVVCFLGILATFGIVMALCESGLADSYIKGIMMTACIAIIMTTSLNLTI
GVLGQLTLGCCGFEAIGAYVAALASKYMVAAGIGVDPTARFLITTLIGGIVACVFGILIG
IPALRLHGDYLAIITLGFGEIIRVIIQNLKVAGGMGLDKGAAGQALIGIERTANLYVVFW
IMVVTVVVLFMFGRSRYGRAVKAIRDDEIAAGASGLNTTYLKVLVFAISAFFAGIAGGIF
AQYIGSLNPTMAGWLNSINYVIMVVFGGMGSLTGSIVSAIGLTILPELLRAFADYRMLAY
SVVLVLVMIFRPQGIFGSWEFSLPKLINRLLLRGNGKNDKAADKSDKAVNEPADATEKEA
AR