Protein Info for BBR_RS18045 in Bifidobacterium breve UCC2003

Annotation: undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 48 to 66 (19 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 224 to 242 (19 residues), see Phobius details amino acids 255 to 281 (27 residues), see Phobius details amino acids 311 to 333 (23 residues), see Phobius details amino acids 338 to 358 (21 residues), see Phobius details PF00953: Glycos_transf_4" amino acids 80 to 241 (162 residues), 132 bits, see alignment E=1e-42

Best Hits

KEGG orthology group: None (inferred from 92% identity to bll:BLJ_1578)

Predicted SEED Role

"Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-)" in subsystem Methicillin resistance in Staphylococci or Teichoic and lipoteichoic acids biosynthesis (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>BBR_RS18045 undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase (Bifidobacterium breve UCC2003)
MRIYLLVAAIAGGVTWLVTPLIRHVAIEIGAVGEVRARDVHTIPTPRMGGLGMLIGFTVA
TIFASRTPFLAGLFQGNYQMWVILAGGIMISLLGMADDLWDLDWMLKLAGQLLISVFVAW
GGLQIISLPLGGSLITASPSLSMAITAFLIVASINAVNFVDGLDGLASGIVAIGGIAFAI
YSYIIARYSPSYASLATLIDVMMVGICVGFILHNWHPAKLFMGDSGSMLLGYLITCASIV
MTGRLDPASIHASIYLPVFMPILLPILVLFLPVLDMCLAIVRRLAKGQSPMHPDRMHLHH
RMLRIGHSVRGAVLILWGWAALIAFGSLTILFFKAQHVAFGMAIAVVVLTIATMYPYLKH
RIPEIQEENATLEAARHNAQHATAVHDDVTPENTRSGSESLPVAGADSSGQENPS