Protein Info for BBR_RS18035 in Bifidobacterium breve UCC2003
Annotation: oligoribonuclease
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 97% identical to ORN_BIFLO: Oligoribonuclease (orn) from Bifidobacterium longum (strain NCC 2705)
KEGG orthology group: K13288, oligoribonuclease [EC: 3.1.-.-] (inferred from 97% identity to blm:BLLJ_1538)MetaCyc: 43% identical to oligoribonuclease (Pseudomonas aeruginosa)
RXN-24101
Predicted SEED Role
"3'-to-5' oligoribonuclease (orn)" in subsystem RNA processing and degradation, bacterial
Isozymes
Compare fitness of predicted isozymes for: 3.1.-.-
Use Curated BLAST to search for 3.1.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-positive bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (216 amino acids)
>BBR_RS18035 oligoribonuclease (Bifidobacterium breve UCC2003) MVDSHDAETYSAKDSRLIWIDCEMTGLDIFGGDELVEVSVVPTDFDLNVLDEGVDYVIKP SEKAVNHMNDFVRQMHTRSGLINEWENGLSLAEAEQKVTEYVLRFTPEGVRPLLAGNTIG SDKKFLDHYMPDLMSHLHYRSVDVSTLKELARRWYPAVYENRPPKNGGHRALADIIESLD ELRYYRKAFMAPAPGPDEAAAKAISADIVSTSILNK