Protein Info for BBR_RS18025 in Bifidobacterium breve UCC2003

Annotation: AmmeMemoRadiSam system radical SAM enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 TIGR04337: AmmeMemoRadiSam system radical SAM enzyme" amino acids 1 to 289 (289 residues), 421.7 bits, see alignment E=9.8e-131 PF04055: Radical_SAM" amino acids 20 to 177 (158 residues), 57.5 bits, see alignment E=1e-19

Best Hits

KEGG orthology group: K04069, pyruvate formate lyase activating enzyme [EC: 1.97.1.4] (inferred from 90% identity to blf:BLIF_1594)

Predicted SEED Role

"COG1180: Radical SAM, Pyruvate-formate lyase-activating enzyme like"

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.4

Use Curated BLAST to search for 1.97.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>BBR_RS18025 AmmeMemoRadiSam system radical SAM enzyme (Bifidobacterium breve UCC2003)
MEKKPLNHFHPGSSVLSFGTAGCNSGCRFCQNFDIAKARIIDKLSVGASPEKIAQVVASR
GIDSVAFTYNDPIVFAEYAIDTAQACRALGIHPIAVTAGYMSAEARPDFYAAMDAANIDL
KGFTEDFYWKVTGTHLADVLATIDYAVNEARTPEGEHVWVKLTTLLIPGLNDDDAQLHAE
CTWIGKHLGPDVPLHFSAFHPSYRIMDVPPTPHETLTRARAIALAEGLHYVYAGNVHDRE
GDTTYCPNPQCHAKLIERDWYRIIADRLSASSGGNGHCPQCGTAIAGRW