Protein Info for BBR_RS18005 in Bifidobacterium breve UCC2003

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 125 to 144 (20 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 240 to 258 (19 residues), see Phobius details amino acids 264 to 287 (24 residues), see Phobius details PF03729: DUF308" amino acids 129 to 200 (72 residues), 34.8 bits, see alignment E=7.9e-13 amino acids 211 to 257 (47 residues), 18.3 bits, see alignment 1.2e-07 amino acids 246 to 291 (46 residues), 20.4 bits, see alignment 2.5e-08

Best Hits

KEGG orthology group: None (inferred from 78% identity to blj:BLD_1909)

Predicted SEED Role

"Probable conserved membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>BBR_RS18005 hypothetical protein (Bifidobacterium breve UCC2003)
MGDSNDGQWNGQPNQNQPNQQGYPQYGAYDSNHGGQYPPQGAQGQNDRQGGANQNPYGPY
AYNPNYGPNGQPAWGPDGQQYQNNGQADGGNQSGWQQTNWYTGDFNPFRLIEEWLPEKAK
TRIRVIYGVVGVAAIALGAALLLVPNKTLALAALLLGVYFVISGVVRIVGALVEPFLPAG
WRVLDVFVGILLTFGGVVVVRNYGMTGQTLALLITMMVGFGWIMEGVMSLVESWRIPHSG
WAIAYAIISIVAGLIVLMSPLSSAVFMVVFGGCAMVVMGVTAVIRAFTFGKPRK