Protein Info for BBR_RS17990 in Bifidobacterium breve UCC2003

Annotation: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03535: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
  • amino acids 5 to 339 (335 residues), 518.9 bits, E=2.2e-160
• PF14789: THDPS_M
  • amino acids 105 to 130 (26 residues), 28 bits, see alignment (E = 1.9e-10)
• PF14602: Hexapep_2
  • amino acids 247 to 278 (32 residues), 57.8 bits, 7e-20

Best Hits

Swiss-Prot: 95% identical to DAPD_BIFLO: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (dapD) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K00674, 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase [EC: 2.3.1.117] (inferred from 95% identity to blm:BLLJ_1526)

Predicted SEED Role

"2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117)" in subsystem Lysine Biosynthesis DAP Pathway (EC 2.3.1.117)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)

KEGG Metabolic Maps

• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.117

Protein Sequence (339 amino acids)

>BBR_RS17990 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (Bifidobacterium breve UCC2003)
MSEARTAWGWGLASVDAAGTTLDVWYPELTLGEAPAESDRPNHNFGTLAHTEADARGIRR
VPVFAVSQLDEPIVNAADAYLKLHLMSMRMAKPNTLNLDGIFAQLANVVWTNYGPFAVED
FTLRKADVERAATDAALAFATQAGLSAAAPATTVNVFGVDKFPRMIDYVVPTGVRIGDAD
RVRLGAYLSAGTTVMHAGFVNFNAGTLGVSMVEGRVSQGVVVGDGSDIGGGASIMGTLSG
GGKLRNSIGEHSLLGANAGIGISLGDNCTVEAGLYVTAGTKITIWDKAKAAAGEPLEVVK
GSDLSGKDNILFIRNSVNGRIEARYRKVGIELNEKLHKN