Protein Info for BBR_RS17975 in Bifidobacterium breve UCC2003

Annotation: very short patch repair endonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF03852: Vsr" amino acids 9 to 78 (70 residues), 100.6 bits, see alignment E=1.8e-33 TIGR00632: DNA mismatch endonuclease Vsr" amino acids 10 to 125 (116 residues), 129.2 bits, see alignment E=4.7e-42

Best Hits

Swiss-Prot: 54% identical to VSR_NEIMA: Putative very short patch repair endonuclease (vsr) from Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

KEGG orthology group: K07458, DNA mismatch endonuclease, patch repair protein [EC: 3.1.-.-] (inferred from 94% identity to bll:BLJ_1558)

Predicted SEED Role

"Very-short-patch mismatch repair endonuclease (G-T specific)" in subsystem DNA repair, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (157 amino acids)

>BBR_RS17975 very short patch repair endonuclease (Bifidobacterium breve UCC2003)
MSRKKQPVEKYERGTRSYTMSHIRGKDTKIEVLVRSYLFRRGLRFRKNDKRYPGHPDVVL
PKYHTIVFVNGCFWHMHEGCSKRSMPKSNVEFWQAKLLRNHNRDIAQRAELEASGWRVIT
VWECELTIAVRDGRLARLYEQIVCPSGFPLEGSCRRR