Protein Info for BBR_RS17940 in Bifidobacterium breve UCC2003

Annotation: large conductance mechanosensitive channel protein MscL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01741: MscL
  • amino acids 33 to 161 (129 residues), 112.6 bits, E=7.8e-37
• TIGR00220: large conductance mechanosensitive channel protein
  • amino acids 35 to 161 (127 residues), 82.8 bits, E=1.2e-27

Best Hits

KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 85% identity to blf:BLIF_1572)

Predicted SEED Role

"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis

Protein Sequence (168 amino acids)

>BBR_RS17940 large conductance mechanosensitive channel protein MscL (Bifidobacterium breve UCC2003)
MANQSPSNIADNLMKSAGSATHAVVALTDKGPLAGFKKFLSRGSMIDMAVGVVIGSAVTT
VVTSIVDNLISPLIGMIGGVPDLSGLLTITFNNSTISFGAILNALINFLLIGVAVYFCVI
LPINKLRDLTAAQDEAEAKEEGPSVEEQTLATLQEIRDELKKSNGSIG