Protein Info for BBR_RS17845 in Bifidobacterium breve UCC2003

Annotation: ECF transporter S component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 51 to 76 (26 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 112 to 136 (25 residues), see Phobius details amino acids 157 to 183 (27 residues), see Phobius details PF12822: ECF_trnsprt" amino acids 18 to 184 (167 residues), 38.1 bits, see alignment E=8e-14

Best Hits

KEGG orthology group: None (inferred from 97% identity to blf:BLIF_1545)

Predicted SEED Role

"Substrate-specific component STY3230 of queuosine-regulated ECF transporter" in subsystem ECF class transporters or Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>BBR_RS17845 ECF transporter S component (Bifidobacterium breve UCC2003)
MARKLSFWEGIKAQFSTKSLVLIPIAVGINLIGGTLCSALKLPLFLDMIGTIVVACLSGP
WVAALTGLLTNLFLALVANPVYLPYAAVSVLCGLVVGYMVKAGLFRKKWGVVVIWLVCTL
VNAISASLITAFVYGGATGVNGTSVLTATLVVAMKDILASVISSSLIENLIDKGITVAIA
WVIVQKIPRRFLSQYAADSVGGSNNDALSDDDEEEDE