Protein Info for BBR_RS17840 in Bifidobacterium breve UCC2003

Annotation: energy-coupling factor transporter transmembrane protein EcfT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 38 to 57 (20 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 130 to 154 (25 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details PF02361: CbiQ" amino acids 11 to 218 (208 residues), 59.7 bits, see alignment E=1.6e-20

Best Hits

KEGG orthology group: K02008, cobalt/nickel transport system permease protein (inferred from 97% identity to blf:BLIF_1544)

Predicted SEED Role

"Transmembrane component STY3231 of energizing module of queuosine-regulated ECF transporter" in subsystem ECF class transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>BBR_RS17840 energy-coupling factor transporter transmembrane protein EcfT (Bifidobacterium breve UCC2003)
MSSHMPVINDTVIEKLNPITKIAAVFALGLSALAWPDFTLGLILVVLLFVVSFLAHIQRN
FAKIMFGFGIPVTVMLMFIQGLYSPKNRTTLLDFGFAQLGLEGVLYAAKVVVSLLVFLGS
FYIMNKTTYVGAMVSALTSVGLSAKAGYLVLASLNVVPQMQRRMAVIQEAQSARGLDASG
GVIARIKAYIPLLGPVVMSSLTDAQERGMTLETRGFGITGVKQTSYVKVSWNAADKVLNW
IFVLFLIAVVAVSVCIRIGVIPSPVSWGGK