Protein Info for BBR_RS17825 in Bifidobacterium breve UCC2003

Annotation: phosphoribosylanthranilate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00697: PRAI
  • amino acids 7 to 200 (194 residues), 46.8 bits, E=1.5e-16

Best Hits

KEGG orthology group: K01817, phosphoribosylanthranilate isomerase [EC: 5.3.1.24] (inferred from 99% identity to blf:BLIF_1541)

Predicted SEED Role

"Phosphoribosylanthranilate isomerase (EC 5.3.1.24)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 5.3.1.24)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• superpathway of chorismate metabolism (32/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.24

Use Curated BLAST to search for 5.3.1.24

Protein Sequence (233 amino acids)

>BBR_RS17825 phosphoribosylanthranilate isomerase (Bifidobacterium breve UCC2003)
MADVIAQIYGIRNVEDARMVIDMGGEHIGVSYGKIKRTPGQLDCERAREIFEGVQPQAVR
IGLTVAEDIDEISENLREAMPDVLHLSGDIEGISPAEVAELKSRFPELKIMQAIPVLAGV
PLGEQKVMQYVKDYEPVSDFFLIDTKAPAAGDIGATGLTHDRAIDRAIIEATDVPCIIAG
GLDASNVAEAIYATHPYGVDSFSLTNYDDDRADTDWCKDPAKVEAFIKAAKDA