Protein Info for BBR_RS17820 in Bifidobacterium breve UCC2003

Annotation: carbohydrate kinase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00294: PfkB
  • amino acids 1 to 304 (304 residues), 177.9 bits, E=1.6e-56

Best Hits

KEGG orthology group: K00874, 2-dehydro-3-deoxygluconokinase [EC: 2.7.1.45] (inferred from 98% identity to blf:BLIF_1540)

Predicted SEED Role

"Fructokinase (EC 2.7.1.4)" in subsystem Fructose utilization or Mannitol Utilization or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization or Sucrose utilization or Sucrose utilization Shewanella (EC 2.7.1.4)

MetaCyc Pathways

• heterolactic fermentation (16/18 steps found)
• sucrose degradation III (sucrose invertase) (4/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (4/4 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• D-sorbitol degradation I (2/3 steps found)
• sucrose degradation I (sucrose phosphotransferase) (1/3 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (5/9 steps found)
• mannitol cycle (2/5 steps found)
• D-fructuronate degradation (1/4 steps found)
• sucrose degradation VII (sucrose 3-dehydrogenase) (1/4 steps found)
• 4-deoxy-L-threo-hex-4-enopyranuronate degradation (1/5 steps found)
• D-galacturonate degradation I (1/5 steps found)
• 3,6-anhydro-α-L-galactopyranose degradation (2/7 steps found)
• superpathway of β-D-glucuronosides degradation (2/7 steps found)
• alginate degradation (1/7 steps found)
• superpathway of hexuronide and hexuronate degradation (2/10 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (5/31 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Pentose phosphate pathway
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.4

Use Curated BLAST to search for 2.7.1.4 or 2.7.1.45

Protein Sequence (318 amino acids)

>BBR_RS17820 carbohydrate kinase family protein (Bifidobacterium breve UCC2003)
MPKVVVVGDANVDVIVPYPRFLNEERTQVEYPQIGIQGGGTSANTAVALAKLGLDVSFVG
TVGDDQYGRFVMQDFKDAGVDVTGLVADSTLNTVGVFAFVDDRGERYLWGWPRERQSFKV
LDENLVPMHMIREADWVHSSGMCLTYDTSARETIIRIFEQAHDAGVPTSFDLNLRVDDGV
LDPDFAAALERIIPNVDYLLGSGPDEFAYLGDDDMMGNATTYAVGGRTVIVRDGARGSIG
LTQDGLTESPAFRVNVEDTIGAGDVYNAGFIAARLAGASLAESLREGNAVSAYKVARRGA
RSSPDAAQLHEFLVGQTG