Protein Info for BBR_RS17810 in Bifidobacterium breve UCC2003

Annotation: HAD family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00702: Hydrolase
  • amino acids 3 to 180 (178 residues), 72.3 bits, E=1.5e-23
• PF13419: HAD_2
  • amino acids 7 to 188 (182 residues), 90.3 bits, E=3.5e-29
• PF12710: HAD
  • amino acids 7 to 179 (173 residues), 47.7 bits, E=5.4e-16
• PF13242: Hydrolase_like
  • amino acids 149 to 213 (65 residues), 46 bits, E=7.9e-16

Best Hits

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 98% identity to blb:BBMN68_1807)

Predicted SEED Role

"Phosphoglycolate phosphatase (EC 3.1.3.18)" in subsystem 2-phosphoglycolate salvage or Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 3.1.3.18)

MetaCyc Pathways

• photorespiration II (3/10 steps found)
• photorespiration I (2/9 steps found)
• photorespiration III (2/9 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Protein Sequence (228 amino acids)

>BBR_RS17810 HAD family hydrolase (Bifidobacterium breve UCC2003)
MEYRCLLWDFDGTLADTGSDVWNSLTYAARRAGGAIDDLYMRDDANLADPMDEIMRHVIP
YPGEAYLETFDEDVRVHYRTLNDFSRTRLYPGIQSMLNELKEHGVRNIIVTNKPEGALSR
ILGSKGWANLFDDWICPDSIPGREATKVEMMAEIVRRHGIAPRQCLYVGDTFSDIEAART
NGISCIAVTYGDGDEIALLSRNPAYVARDIAELNDIMTDTVIHARSMI