Protein Info for BBR_RS17805 in Bifidobacterium breve UCC2003

Annotation: NADH-dependent alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00465: Fe-ADH
  • amino acids 10 to 364 (355 residues), 294.3 bits, E=1.2e-91
• PF13685: Fe-ADH_2
  • amino acids 14 to 111 (98 residues), 37.1 bits, E=3.1e-13

Best Hits

Swiss-Prot: 38% identical to ADH2_GEOTN: Long-chain-alcohol dehydrogenase 2 (adh2) from Geobacillus thermodenitrificans (strain NG80-2)

KEGG orthology group: K00100, [EC: 1.1.1.-] (inferred from 99% identity to blf:BLIF_1537)

MetaCyc: 38% identical to BdhA (Clostridium acetobutylicum)
1.1.1.-

Predicted SEED Role

"NADH-dependent butanol dehydrogenase A (EC 1.1.1.-)" in subsystem Butanol Biosynthesis (EC 1.1.1.-)

MetaCyc Pathways

• butanol and isobutanol biosynthesis (engineered) (3/8 steps found)
• pyruvate fermentation to butanol II (engineered) (1/6 steps found)
• glycerol degradation to butanol (7/16 steps found)
• pyruvate fermentation to butanol I (1/8 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (3/13 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (13/27 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (5/17 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Tetrachloroethene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.-

Protein Sequence (401 amino acids)

>BBR_RS17805 NADH-dependent alcohol dehydrogenase (Bifidobacterium breve UCC2003)
MRDFTICIGTTFVFGRDAETKVGDELGAKGVSRVLIHHDGGAYLEASGLLDAVRHSLGRA
GISYTELGGVKPNPRLTLVREGIAIAKARNVDAVVAIGGGSVIDSAKAIALGAAGERDVW
DYFTGKVPVERTLPVAVVLTCPASGSESSQVAVINNEHEHSKLTLSEPVLRPAFAFMNPE
LSVTVPAFPTACGIVDMFSHICERYFSAGNEIGVIDRMAEGALRTLVDVGPKSLADLADY
DLRAQIMWISTIAQNNTLGVGREQDWSTHLIANELSALYDTPHGATLSIIMGSWMRVASE
KAPFRFARYATEVFGTRPGSMNETELARRGIAATESFFRSLGMPVSFKDFDLPGDGIERM
LDNIDFYGPDATIGSIARLDRDDCRRIYELALTGPVMGKES