Protein Info for BBR_RS17795 in Bifidobacterium breve UCC2003

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 transmembrane" amino acids 32 to 55 (24 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 100 to 126 (27 residues), see Phobius details amino acids 132 to 149 (18 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details amino acids 214 to 233 (20 residues), see Phobius details amino acids 239 to 257 (19 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details amino acids 339 to 359 (21 residues), see Phobius details amino acids 365 to 383 (19 residues), see Phobius details amino acids 406 to 425 (20 residues), see Phobius details amino acids 445 to 465 (21 residues), see Phobius details PF07690: MFS_1" amino acids 38 to 416 (379 residues), 82.2 bits, see alignment E=1.8e-27

Best Hits

KEGG orthology group: None (inferred from 99% identity to blf:BLIF_1535)

Predicted SEED Role

"Similar to tetracycline resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (481 amino acids)

>BBR_RS17795 MFS transporter (Bifidobacterium breve UCC2003)
MAETAVKEKANGIPVPEEGTEEFARMNKMAKIAIPIVLIIFTMGVLQQQAFGMIYVNIGD
QLGQANLAPLITSIPGIVLGIVCVIYGSLGDFVSLKKMMILGTIVFVLGSILGCFGDLSI
WIVIAARTVQSAGWQVSGSIFLVLVSKYIEKKKRVIWYGVFVAVFRIAAALGVFLAGYMT
LVDWRILFGIGIIAVFFIPILAKNLPDEHAKGARIDVIGFTLIGLFAGSVTMFFTDMTIF
WGIAVLVTGVAFVVYINKAADPFITPKMLTNPAFAMTMIVIFVGYFFSYTLNAGCNAIGL
NVYGIDSSQVSNLLVWSIILAAIMGFAAGPIIQKIGRKASIILALACMGGGLIAVAFLIP
MGQIWALAVAPCIYYFGTSFFYQPIVDTATLTVEAEESGRALGFNDLMQAITGSVGVAIF
GQLMANGAMSGGSLFGTESGPASTYANVFMVGGIIVLGAMVIFICSMKMIYSRSRVAEDE
S