Protein Info for BBR_RS17775 in Bifidobacterium breve UCC2003

Annotation: LacI family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF00356: LacI" amino acids 5 to 50 (46 residues), 56.4 bits, see alignment 4.2e-19 PF00532: Peripla_BP_1" amino acids 61 to 308 (248 residues), 62.1 bits, see alignment E=1.3e-20 PF13407: Peripla_BP_4" amino acids 64 to 309 (246 residues), 36.7 bits, see alignment E=7.4e-13 PF13377: Peripla_BP_3" amino acids 172 to 331 (160 residues), 83.5 bits, see alignment E=3.9e-27

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 80% identity to bll:BLJ_1522)

Predicted SEED Role

"transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>BBR_RS17775 LacI family DNA-binding transcriptional regulator (Bifidobacterium breve UCC2003)
MAFVTLKDVAQQAGVSAAAVSQILHDKGRFSNETRQLVLKTVEEMGYVPDQRARSMRSSA
TKTVGLLVPDLRNAYFAELVSSMEEGLYAHGFSTLIGTSAETVKRQDAFIKNLLGQRIDG
AIVVPQGSDSPGVKSLIARDLPLVFVDRRVQGIESVPFVVSDPYTGIREAMEELVALGHR
RIGYIAHSSLESYSVNEREVAFRTAAPELLHGDTGIVVDCGSTYESRCHTVDYLLECGVT
AIICAYSPDAITIIGLLHDRGIELGTQMSLISFDDIAPFRLMTPKISVISQQAEQMGRQG
VDLLLEAMQSGVHQGGSTIHVPTVYLSRGSVARVVVSAQ