Protein Info for BBR_RS17765 in Bifidobacterium breve UCC2003

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 254 to 271 (18 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 54 to 316 (263 residues), 139.1 bits, see alignment E=7.8e-45

Best Hits

Swiss-Prot: 49% identical to RBSC_BACSU: Ribose import permease protein RbsC (rbsC) from Bacillus subtilis (strain 168)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 98% identity to bll:BLJ_1520)

MetaCyc: 40% identical to D-allose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-42-RXN [EC: 7.5.2.8]

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>BBR_RS17765 ABC transporter permease (Bifidobacterium breve UCC2003)
MTAKEQKLGYDSGSVSTLDKVKRFASRNGALIGLIILCIILSIATPAFLTGPNLLNVGIQ
AATVAILAFGQTFVIVEAGIDLSVGSVAAVSSMLVAYTGASMGLPPILTIVVGLVTGAVF
GALSGIANAFLKLPSFIATLAMMSVARGLTLVISDGRPVSTSGMVNFFGSTVLGIPIPIV
MMIIMGVIASVILNFTSIGRSMYAVGGNMEASRLSGISVHKTQIMVFVLSGIFAAVAGLV
IAGRLHSAQPQAASGYEMDAIASVVIGGASLSGGKGKISGTFIGAILLAVIRNGLNILNV
SSFWQQVVIGLVIAFAVSFDTLRRKVDAH