Protein Info for BBR_RS17640 in Bifidobacterium breve UCC2003

Annotation: DNA-directed RNA polymerase subunit omega

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00690: DNA-directed RNA polymerase, omega subunit
  • amino acids 13 to 82 (70 residues), 68.7 bits, E=1.8e-23
• PF01192: RNA_pol_Rpb6
  • amino acids 19 to 78 (60 residues), 50.2 bits, E=1e-17

Best Hits

Swiss-Prot: 97% identical to RPOZ_BIFLS: DNA-directed RNA polymerase subunit omega (rpoZ) from Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

KEGG orthology group: K03060, DNA-directed RNA polymerase subunit omega [EC: 2.7.7.6] (inferred from 96% identity to blb:BBMN68_15)

Predicted SEED Role

"DNA-directed RNA polymerase omega subunit (EC 2.7.7.6)" in subsystem RNA polymerase bacterial (EC 2.7.7.6)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.6

Use Curated BLAST to search for 2.7.7.6

Protein Sequence (94 amino acids)

>BBR_RS17640 DNA-directed RNA polymerase subunit omega (Bifidobacterium breve UCC2003)
MAFGTDPTPDGLANPPIDDLMQHADSKYALAIFAAKRARQINSYFTQLNEGLLQNVGPLV
EYQNNEKPLSIAFREIDEALLEETLGEDDTNEGN