Protein Info for BBR_RS17625 in Bifidobacterium breve UCC2003

Annotation: HAD family phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13419: HAD_2
  • amino acids 79 to 209 (131 residues), 43.7 bits, E=5.3e-15
• PF00702: Hydrolase
  • amino acids 99 to 207 (109 residues), 38.4 bits, E=2.8e-13
• TIGR01509: HAD hydrolase, family IA, variant 3
  • amino acids 117 to 211 (95 residues), 40.8 bits, E=1.3e-14
• PF13242: Hydrolase_like
  • amino acids 169 to 211 (43 residues), 25.1 bits, 2.1e-09

Best Hits

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 93% identity to blb:BBMN68_18)

Predicted SEED Role

"possible alpha beta hydrolase"

Protein Sequence (234 amino acids)

>BBR_RS17625 HAD family phosphatase (Bifidobacterium breve UCC2003)
MKGWPGEPDMDYNVLVADGEAATNAGKPITDVIFDFGNVLIYWDPAAVLIPRYSQKTIDA
FLDNDISGFYDVNDLMDGGTSTEEAIAIMRERKGDKWADILDYYIKNFRDSLTGIVPGAR
VLVDDLKAAGIGVWGLSNWEASLFHVAEEQCDILQKLDGKLVSGFVKLRKPHKEIYDAAL
KEFGIKADGALFIDDKAMNIVGSNAAGIRGVRFQDPVKLRELLIANGVNIPDVQ