Protein Info for BBR_RS17615 in Bifidobacterium breve UCC2003

Annotation: phosphoserine phosphatase SerB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 TIGR00338: phosphoserine phosphatase SerB" amino acids 28 to 238 (211 residues), 250.8 bits, see alignment E=1.1e-78 TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB" amino acids 35 to 205 (171 residues), 102.6 bits, see alignment E=2.5e-33 PF00702: Hydrolase" amino acids 36 to 206 (171 residues), 70.6 bits, see alignment E=6.2e-23 PF12710: HAD" amino acids 37 to 203 (167 residues), 83.6 bits, see alignment E=6.3e-27 PF08282: Hydrolase_3" amino acids 170 to 226 (57 residues), 42.7 bits, see alignment E=1.5e-14 PF05116: S6PP" amino acids 170 to 218 (49 residues), 21.9 bits, see alignment 3e-08

Best Hits

Swiss-Prot: 60% identical to SERB_STRT2: Phosphoserine phosphatase (serB) from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)

KEGG orthology group: K01079, phosphoserine phosphatase [EC: 3.1.3.3] (inferred from 89% identity to blo:BL1792)

Predicted SEED Role

"Phosphoserine phosphatase (EC 3.1.3.3)" in subsystem Glycine and Serine Utilization or Serine Biosynthesis (EC 3.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.3

Use Curated BLAST to search for 3.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (240 amino acids)

>BBR_RS17615 phosphoserine phosphatase SerB (Bifidobacterium breve UCC2003)
MTQEDVHFIDKSAESEVGALGGSADSVPTLAEPGLLVMDVDSTLIDEEVIDELGEAAGSG
EEIAKVTERAMRGELEFCDALRARVALLEGLPVSVFDTVHDKLHFTKGALELIDTLHAHS
WKVGVVSGGFHEVVDKLAAEGHIDYWIANRLEVADGRLTGKVLGEIVCKTVKLHALRKWA
KQLDIPMSQTVAVGDGANDIPMIQAASLGIAFCAKPKTQLAADEAINDRDLMHVLDYLRR