Protein Info for BBR_RS17610 in Bifidobacterium breve UCC2003

Annotation: DedA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 29 to 52 (24 residues), see Phobius details amino acids 73 to 96 (24 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 191 to 215 (25 residues), see Phobius details PF09335: SNARE_assoc" amino acids 55 to 183 (129 residues), 81.7 bits, see alignment E=3.2e-27

Best Hits

KEGG orthology group: None (inferred from 90% identity to blj:BLD_1970)

Predicted SEED Role

"hypothetical conserved transmembrane protein in the DedA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>BBR_RS17610 DedA family protein (Bifidobacterium breve UCC2003)
MELATALAANPTPICTTSEGGLIGTITEWLITLMETIGGVGVALAIALESVFPPIPSEVI
LPLAGFTAARGTLSLPGAIIWATIGSLLGAWTLYGISRWVGLHRINRAADKIPGVSRKDV
SKANDWFTRYGTWSVLIGRVIPVVRSLISIPAGFNRMNFLQFTGWTLLGSAVWNTILVSA
GYLLGDQWCSIQGALGVFEDVVIVAVVVVIVWFAVKKVRTVVRNRKAQHGE