Protein Info for BBR_RS17580 in Bifidobacterium breve UCC2003

Annotation: PTS fructose transporter subunit IIB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00829: PTS system, Fru family, IIB component
  • amino acids 4 to 88 (85 residues), 111.4 bits, E=1e-36
• PF02302: PTS_IIB
  • amino acids 6 to 95 (90 residues), 76.3 bits, E=1.2e-25

Best Hits

Swiss-Prot: 58% identical to PTFB2_SHIFL: PTS system fructose-like EIIB component 2 (frwB) from Shigella flexneri

KEGG orthology group: K02769, PTS system, fructose-specific IIB component [EC: 2.7.1.69] (inferred from 77% identity to sak:SAK_1761)

MetaCyc: 58% identical to putative PTS enzyme IIB component FrwB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Protein Sequence (103 amino acids)

>BBR_RS17580 PTS fructose transporter subunit IIB (Bifidobacterium breve UCC2003)
MKIVGVSACTVGIAHTYMAQQKLEDAAKAAGDEVKIETQGTIGVENELTAQDIADADIVI
LAIDIKIANEERFAGKKVVKVSTETAIKAPNKLIAKLHEIAEK