Protein Info for BBR_RS17575 in Bifidobacterium breve UCC2003

Annotation: PTS fructose-like enzyme IIC component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 transmembrane" amino acids 15 to 40 (26 residues), see Phobius details amino acids 56 to 81 (26 residues), see Phobius details amino acids 94 to 121 (28 residues), see Phobius details amino acids 133 to 156 (24 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details TIGR01427: PTS system, Fru family, IIC component" amino acids 11 to 343 (333 residues), 202.9 bits, see alignment E=4.4e-64 PF02378: PTS_EIIC" amino acids 17 to 277 (261 residues), 38.2 bits, see alignment E=4.7e-14

Best Hits

KEGG orthology group: K02770, PTS system, fructose-specific IIC component (inferred from 69% identity to kpn:KPN_01741)

Predicted SEED Role

"PTS system, fructose-specific IIC component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>BBR_RS17575 PTS fructose-like enzyme IIC component (Bifidobacterium breve UCC2003)
MKNFWKAANFKGHLLTAISYMIPIVCGAGFVIAIGMAFGGTSQDSLVMGKFNFLEALATL
GGKALGMLPVIIATGIAFSIAGKPGIAPGFVVGLAANSISAGFIGGIIGGYVAGWIAVAV
IKFVKVPSWAKGLMPTLIVPFLASLSSGLIMVYIIGTPVSWFTSWLTNLLQSMSGASNLI
FGAVIGTLSIVDFGGPINKTAFAFALTLQAEGLNGAVTALQLTNTATPIGFGFAFLVAKL
LRKNIYTREEVETLKSSVPMGVVNIVEGTIPIVMNDLVRGIVAAGLGGCVEGAILMSLAN
GEGATVPFGGFLMLPTMGSNWWVGLLAIAANVVVTGVVYALIKKDIPADQLDAVQSSSAE
EEELDLDDIKVM