Protein Info for BBR_RS17550 in Bifidobacterium breve UCC2003

Annotation: Pup--protein ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 TIGR03686: Pup--protein ligase" amino acids 27 to 483 (457 residues), 625 bits, see alignment E=3.5e-192 PF03136: Pup_ligase" amino acids 28 to 454 (427 residues), 459.7 bits, see alignment E=5.9e-142

Best Hits

Swiss-Prot: 87% identical to PAFA_BIFLS: Pup--protein ligase (pafA) from Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

KEGG orthology group: K13571, proteasome accessory factor A [EC: 6.3.2.-] (inferred from 87% identity to blb:BBMN68_26)

Predicted SEED Role

"Pup ligase PafA, possible component of postulated heterodimer PafA-PafA'" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Proteasome archaeal

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.-

Use Curated BLAST to search for 6.3.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (495 amino acids)

>BBR_RS17550 Pup--protein ligase (Bifidobacterium breve UCC2003)
MPQLRDSGTRSLHASEPVPSAEMDGFCRIFGVETEYGVSVTGASKPVDAGQVAMIMFQPV
VSRSRSTNTYLDNGSRLYLDVGSHPEYATAEARDPREALAQDLAGEQVMRNLALKAQRKL
RETHGERAMIHVFKNNVDSAGHAFGCHENYLVRRFVPLETIEHQLLPFLITRQLFTGAGR
MTPDGFQITQRADFLDEAVSSATTRSRPMVNTRDEPHADPDSFRRLHVIIGDSNRSQWAT
WMKLAVTHLVLCVIEDAFRNEVPSGFEDYAFADPAAANRAVSRFPDNSHAELALESGESV
TALDLQRRYYAAVEAFITNHDDALVGSLPVTGIKTVMGEWHRALDALDHGEYDALADRVD
WAAKKRLFDALRKRRPDVTFAQLEQLELDYHDIANGRLYGSLTSRNQLRELLTSNDVAIA
VHNPPTDTRAALRGQFVRAALAAGAQFSADWTHLTVAAPERREAVLLDPFESEPTEEFTQ
LMGVLPNGSDEPVQV