Protein Info for BBR_RS17490 in Bifidobacterium breve UCC2003

Annotation: MoxR family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 PF20030: bpMoxR" amino acids 47 to 220 (174 residues), 48.1 bits, see alignment E=1.5e-16 PF07726: AAA_3" amino acids 73 to 203 (131 residues), 191.6 bits, see alignment E=9.3e-61 PF07728: AAA_5" amino acids 79 to 201 (123 residues), 43.8 bits, see alignment E=5.1e-15 PF17863: AAA_lid_2" amino acids 286 to 352 (67 residues), 74 bits, see alignment E=1.3e-24

Best Hits

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 93% identity to blb:BBMN68_40)

Predicted SEED Role

"widely conserved MoxR-like protein in magnesium chelatase family"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>BBR_RS17490 MoxR family ATPase (Bifidobacterium breve UCC2003)
MTLFPTQPNMPPKPAAARPAAVPTPSAAAPLGADDAKRARALADSIRARFAQTLVGQDNL
RESLIVTLVAGGHILIESVPGLAKTTAAQTLATCVSGSFKRVQCTPDLMPSDLVGTQVFD
FASQKFTTQIGPIHANFVLLDEINRSNAKTQSAMLEAMAEGTTTIGGQRIALPKPFMVIA
TENPIEEEGTFNLPEAQMDRFMMKAVMTYPTADQEARMLAMLTRRGSDMIGPDSITGERI
TVADVDFLRTAARRVHVSDAIMRYAVDIAATSRGAGSRPIKGLSSLVRLGASPRATIALI
RIGQAKALLSGRDYVVPEDIKAFAHEVLRHRIMLTFEALADGVVSDQIVDKIVETVPVP