Protein Info for BBR_RS17455 in Bifidobacterium breve UCC2003

Annotation: DNA-binding response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00072: Response_reg
  • amino acids 9 to 119 (111 residues), 106.4 bits, E=9.5e-35
• PF00486: Trans_reg_C
  • amino acids 153 to 237 (85 residues), 78.2 bits, E=4.2e-26

Best Hits

Swiss-Prot: 44% identical to MPRA_MYCSJ: Response regulator MprA (mprA) from Mycobacterium sp. (strain JLS)

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 99% identity to bll:BLJ_1474)

Predicted SEED Role

"Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain"

Protein Sequence (243 amino acids)

>BBR_RS17455 DNA-binding response regulator (Bifidobacterium breve UCC2003)
MSKPIEASIVVVDDEPSIRELLVASLHFAGFEVNTAASGSEAIEVIEKVQPDLIVLDVML
PDIDGFTVTRRIRQEGIDAPVLFLTARDDTQDKIMGLTVGGDDYVTKPFSLEEVVARIRA
ILRRTREQVEDDPIIRVADLEINEDSHDVSRAGQPIDLSPTEYKLLRYLMDNEGRVLSKA
QILDHVWQYDWGGDAAIVESYISYLRKKVDGIEVDDGEGGKRKVTPLIETKRGIGYMIRE
PKN