Protein Info for BBR_RS17450 in Bifidobacterium breve UCC2003

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 641 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 247 to 270 (24 residues), see Phobius details PF00672: HAMP" amino acids 269 to 320 (52 residues), 50 bits, see alignment 4.5e-17 PF00512: HisKA" amino acids 333 to 401 (69 residues), 65.2 bits, see alignment E=6.8e-22 PF02518: HATPase_c" amino acids 465 to 611 (147 residues), 67.9 bits, see alignment E=1.5e-22

Best Hits

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (641 amino acids)

>BBR_RS17450 sensor histidine kinase (Bifidobacterium breve UCC2003)
MKEHHNRKKNMFFGHFDRISLSSKLVACTIAVLLIGVSVISFSIRALVSNYMLSKTDNQL
KSQSQMVFENIVTLAKNDNAGPNSYFLQIQYTDGTLDNEGNPLVVTPLMPQLQDGIVSVP
VLPTDGDTSDITFGQPFTTQAVVKQVVQIQNNSSDSNNTTKPQTDPNTQDDAGNDAGNSG
SKNAPNSSNSVTTILSNPSSNANHAAVSTARSPWRILPMTFTENGKERAVVYIGLSLSDQ
IDIVSTLSRYCVVVGIAVVLLGGSLATLIIQHTMTPLKRMEKTAAKIAAGDLSQRIPSAP
ENTEVGSLAASLNTMLTRIELSFHEQEETTDKMKRFVSDASHELRTPLAAIHGYAELYKM
QRDMPGALDRADESIEHIERSSQRMTVLVEDLLSLARLDEGRGIDVTGTVKLSSLVTDAV
DDLHALDPDRAIGRMLIGLEPARDLNHPASLSLTEGDWPTITLPGDASRLRQVVTNIVGN
IHRYTPIDSSAEIALGVMPAAIDPKQLSGLPATDTSMRRFVEAAEVGASMSTGYRYAVLR
FVDHGPGVPDESRPKIFERFYTADPSRAREKGGTGLGMAIAQSVVKAHHGFICATATDGG
GLTFTVVLPIEQMPAAQSAQTAGKTKEAKQKSSWFGGERKS