Protein Info for BBR_RS17390 in Bifidobacterium breve UCC2003

Annotation: histidine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 TIGR00442: histidine--tRNA ligase" amino acids 6 to 445 (440 residues), 323.5 bits, see alignment E=1e-100 PF13393: tRNA-synt_His" amino acids 9 to 346 (338 residues), 83.8 bits, see alignment E=1.3e-27 PF03129: HGTP_anticodon" amino acids 366 to 417 (52 residues), 30.4 bits, see alignment 3.5e-11

Best Hits

Swiss-Prot: 97% identical to SYH_BIFLO: Histidine--tRNA ligase (hisS) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K01892, histidyl-tRNA synthetase [EC: 6.1.1.21] (inferred from 96% identity to bln:Blon_0705)

Predicted SEED Role

"Histidyl-tRNA synthetase (EC 6.1.1.21)" (EC 6.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>BBR_RS17390 histidine--tRNA ligase (Bifidobacterium breve UCC2003)
MAKGASISGFPEWLPSERVVEQRVIDTLRKVFELNGFIGIETRAVETGASLLKKGETSKE
IYLLSRLQEVGHESDTPIEDRLGLHFDLTVPLSRYVVEHSGALTFPFKRWQIQKVWRGER
PQEGRFREFVQADIDVIGAGDLPDHYEVELPLVMVSALEELRAYGLPKATVHANNRKLSE
GFYRGLGLTDIEGVLREIDKLDKIGADEVARLLSETCGATEAQARACLELAELTASDGAE
LAAKFDALCEAHGIAEDSEAYELARQGLDTLAMIVDEAAAIRPGSVIADLKIARGLDYYT
GSVYETFLDGAASLGSICSGGRYDNLASQGNRKYPGVGLSIGLSRLVSYMLHTAGAHANR
VSPAAVLVAVWNEEDRPTANRIAAQLRARGIATDVAPTAAKLGKQIKYADKLGIPYVWFP
ASAAEGEESTGDEVKNIVTGEQVAADCTSWEPDTVVAQQTVEI