Protein Info for BBR_RS17375 in Bifidobacterium breve UCC2003

Annotation: amino acid ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 55 to 203 (149 residues), 134.5 bits, E=8.3e-43
• PF13401: AAA_22
  • amino acids 66 to 217 (152 residues), 27.4 bits, E=7.6e-10

Best Hits

Swiss-Prot: 72% identical to GLUA_CORGL: Glutamate transport ATP-binding protein GluA (gluA) from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

KEGG orthology group: K10008, glutamate transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 93% identity to bln:Blon_0709)

MetaCyc: 59% identical to glutamate/aspartate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"ABC-type polar amino acid transport system, ATPase component"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Protein Sequence (280 amino acids)

>BBR_RS17375 amino acid ABC transporter ATP-binding protein (Bifidobacterium breve UCC2003)
MSETNNETAVRSRTTREESQGEAPLAPLVPGNEDPNRPLVELTHVEKHFGDLHVLKDINM
TVTKGEVLVVVGPSGSGKSTMCRTINRLETIDSGDVRIDGKPLPQEGKELANLRAEVGMV
FQSFNLFANKTILENVTLAPIKVRHMDKKEAEQLAMDLLARVGVDSQANKMPSQLSGGQQ
QRVAIARALAMRPKVMLFDEPTSALDPEMVNEVLDVMVELAHEGMTMICVTHEMGFARKA
ADRIVFMADGQILEENTPDEFFEHPQTERAKDFLSKILTH