Protein Info for BBR_RS17370 in Bifidobacterium breve UCC2003

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF00497: SBP_bac_3" amino acids 38 to 251 (214 residues), 175.8 bits, see alignment E=9.3e-56

Best Hits

Swiss-Prot: 45% identical to GLUB_COREF: Glutamate-binding protein (gluB) from Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)

KEGG orthology group: K10005, glutamate transport system substrate-binding protein (inferred from 97% identity to bll:BLJ_1453)

Predicted SEED Role

"glutamate-binding protein of ABC transporter system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>BBR_RS17370 ABC transporter substrate-binding protein (Bifidobacterium breve UCC2003)
MTFTNTFKRRACRVVAALAAVACTMSLAACGQDEPGKIRIGIKFDQPGLGFKKSGTYVGF
DVDVAKYIAKKLGYSEDEIIWKEAPSKQREAMIQNGDVDMILATYSITDERKKAVSFAGP
YFVAGQDLLVRKDDNSINGPEDLNGKRLCSVTGSTSAATVKEKFASEVQLMEQPGYAECA
TALFSGIVDAVTTDDIILAGLASASRGKLKVVGKPFTQEYYGVGIKKGNTQLATKINNAI
VDMIQDGSWENAISDNTKGTNYTPDVRYNPPTPDEGEKN