Protein Info for BBR_RS17365 in Bifidobacterium breve UCC2003

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 transmembrane" amino acids 18 to 41 (24 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 92 to 109 (18 residues), see Phobius details amino acids 191 to 217 (27 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 14 to 114 (101 residues), 49.2 bits, see alignment E=3e-17 PF00528: BPD_transp_1" amino acids 34 to 221 (188 residues), 48.3 bits, see alignment E=5.1e-17

Best Hits

Swiss-Prot: 50% identical to GLUC_COREF: Glutamate transport system permease protein GluC (gluC) from Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)

KEGG orthology group: K10006, glutamate transport system permease protein (inferred from 97% identity to blj:BLD_0022)

Predicted SEED Role

"ABC-type amino acid transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>BBR_RS17365 ABC transporter permease (Bifidobacterium breve UCC2003)
MNGFLELFSQYDVLGAFLVNIELTLWSALFSMILGVILVVMRISPISSLRTVAGAYVELF
KNLPLTIIMVFMVLGAYAQLKLSFSDTFATNFFWLAVTGLSLYTAAFVCESLRSGINTVP
LGQAEAARALGLGFMQSATEIILPQAFRGSVAPLGNTLIALLKNSTVAAAASVATETSSL
MSEMIEFRPDVIVQIFLIFALGYVILIIPIGMLTTYLSNKLAVRR