Protein Info for BBR_RS17360 in Bifidobacterium breve UCC2003

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 110 to 131 (22 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 198 to 224 (27 residues), see Phobius details amino acids 237 to 260 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 70 to 165 (96 residues), 63.4 bits, see alignment E=1.2e-21 PF00528: BPD_transp_1" amino acids 90 to 271 (182 residues), 69.9 bits, see alignment E=1.2e-23

Best Hits

KEGG orthology group: K10007, glutamate transport system permease protein (inferred from 92% identity to blf:BLIF_1472)

Predicted SEED Role

"ABC-type amino acid transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>BBR_RS17360 amino acid ABC transporter permease (Bifidobacterium breve UCC2003)
MADTSNSVLFDAPGPKGRRTIRIVNWIAALIFVAVLVLVLMRLHNPPDGENQLSWELWKP
AVEREAWTDFYLPGLWMTIKATVLAVVGAVAFGLVFGVGRLLPNPLVRGISAVIVEFCRA
VPVLLLMIFFWRWFAFAGLPSPSYWAVVLALVLYNGSVVAELVRSGVGNLPGGQREASLA
LGLTETQSLIQIEVPQAVYAMLPAAVTQLVVVLKDTALGSIIMYTDLLQESRRLGSMYFN
ILQTLVMAAVIYFVACWLLSRLAEWLPSRMQQRTAAPTEPEPLAPIAAGDPSNVNQIAVA
KEVEELPFGGAPRKYHVHHRGTNASIRNWRRTRYEQGYDVTHPESQTDPNTGEFPAFLKS
EDKPEA