Protein Info for BBR_RS17330 in Bifidobacterium breve UCC2003

Annotation: replication-associated recombination protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 PF05496: RuvB_N" amino acids 24 to 149 (126 residues), 58.6 bits, see alignment E=2.9e-19 PF14532: Sigma54_activ_2" amino acids 58 to 155 (98 residues), 25.4 bits, see alignment E=6.6e-09 PF00004: AAA" amino acids 63 to 167 (105 residues), 61.2 bits, see alignment E=6.8e-20 PF07728: AAA_5" amino acids 63 to 153 (91 residues), 26.4 bits, see alignment E=2.8e-09 PF16193: AAA_assoc_2" amino acids 198 to 281 (84 residues), 83.6 bits, see alignment E=4.3e-27 PF12002: MgsA_C" amino acids 282 to 447 (166 residues), 229.8 bits, see alignment E=8.1e-72

Best Hits

Swiss-Prot: 45% identical to RARA_ECOLI: Replication-associated recombination protein A (rarA) from Escherichia coli (strain K12)

KEGG orthology group: K07478, putative ATPase (inferred from 96% identity to bln:Blon_0716)

Predicted SEED Role

"ATPase, AAA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (459 amino acids)

>BBR_RS17330 replication-associated recombination protein A (Bifidobacterium breve UCC2003)
MSENDLFGAADAPESMTRPLAVRMRPRTLDEVIGQTQVLGQGSPLRRLANPASKGSLTAP
SSVILFGPPGVGKTTLATIVAGQSGRVFEELSAVTSGVKDVRDVLTRAHERLVSRGQETV
LFIDEVHRFSKSQQDALLPAVENRDVTFIGATTENPSFSVIKPLLSRSVVVKLESLEPDQ
LTELVQRALADERGLKGEVKATDEAVADIVRMAGGDARKSLTILEAAAGAVTGDEARKKG
ARRPIITPDIVSTVMDTATVRYDKDGDDHYDVISAFIKSMRGSDPDATIHYLARMLKAGE
DPRFIARRIMIAASEEVGLAAPQILQVTVAAAQAVALVGMPEARIILAEAALAVATAPKS
NAGYNAINQALADVDAGRIGAVPLYLRNAPTKLMKEWGNHEGYKYAHDWPGAVAPQEYLP
EELRGTEYYHPNDRGYEHEVSQRLARIRPILHGEAPDQK