Protein Info for BBR_RS17315 in Bifidobacterium breve UCC2003

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 204 to 230 (27 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 314 to 337 (24 residues), see Phobius details amino acids 348 to 366 (19 residues), see Phobius details amino acids 372 to 393 (22 residues), see Phobius details amino acids 411 to 434 (24 residues), see Phobius details amino acids 454 to 477 (24 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 424 (400 residues), 146.3 bits, see alignment E=1.2e-46 PF00083: Sugar_tr" amino acids 50 to 191 (142 residues), 42.2 bits, see alignment E=5.2e-15

Best Hits

KEGG orthology group: None (inferred from 90% identity to blo:BL0037)

Predicted SEED Role

"transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (486 amino acids)

>BBR_RS17315 MFS transporter (Bifidobacterium breve UCC2003)
MPEQHSDNEKIPVRLIGAIVAVGSLAFIGILTETVMTVLFPTLMREFHVDTATVQWITTI
YLLSVAATMPISSFLKRRFTLKTIFLAAVILAIIGSLIMIFSQAFPLLIVARIIQGIGSG
VATPLMINIILEQSPRTKIGRLMGVGSLVITVAPAIGPTVGGAVTTVLPWRAIFVIAIPL
VLLAAVIGLKCIEQKTPTEAAYLDPVQLGSIILALVGLVLALNQGGVAVSAAVAGGSVAH
SGAIAIISLIVGVGMLIVFALTSKRAFSPLLRLGILKDPAVLLHACAYLLLPLVAIGYGY
VITNVSQLSLGTTAFVAGSLVLPGALIGAACAPLGGWFYDKFGAVKPILIPIGIAIVGPV
LMLIFSMRLTPVLLAGFYFIFGLFYAVGNANVMTSGLSEVSPEFKPDGNAIFNTCLQFGG
AAGTALFSTILSVAQAGAGEEGTAEFAHATAVGGAWTFAAMTIICLIGWGCLAAAFHIRT
ARKRVQ