Protein Info for BBR_RS17300 in Bifidobacterium breve UCC2003

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 32 to 50 (19 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details PF04020: Phage_holin_4_2" amino acids 3 to 114 (112 residues), 65.4 bits, see alignment E=3.3e-22

Best Hits

KEGG orthology group: K08972, putative membrane protein (inferred from 92% identity to bln:Blon_0720)

Predicted SEED Role

"FIG00424399: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (121 amino acids)

>BBR_RS17300 membrane protein (Bifidobacterium breve UCC2003)
MRSFLTSWLIMTIAAAVMVAVIPGMTPVGEPPILGIAAFALFMALINASIKPIVHLVSLP
FAILSLGLVTLIINWLFMRLASWLAVSLFGVGVFVHGFRWSVLGSLVLTIVSSIVGAIID
Q